Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Orientia tsutsugamushi 56 kDa type-specific antigen

This Recombinant Orientia tsutsugamushi 56 kDa type-specific antigen spans the amino acid sequence from region 23-532.

Product Specifications

Product Name Alternative

56 kDa type-specific antigen, TSA, 56 kDa scrub typhus antigen, STA56, TSK56

UniProt

P37915

Expression Region

23-532

Origin

Orientia tsutsugamushi (Rickettsia tsutsugamushi)

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

IELGEEGLECGPYAKVGVVGGMITGVESARLDPADAEGKKHLSLTNGLPFGGTLAAGMTI APGFRAEIGVMYLTNITAQVEEGKVKADSVGETKADSVGGKDAPIRKRFKLTPPQPTIMP ISIAVRDFGIDIPNQTSAASTSRSLRLNDEQRAAARIAWLKNCAGIDYRVKNPNDPNGPM VINPILLNIPQGNPNPVGNPPQRANPPAGFAIHNHEQWRHLVVGLAALSNANKPSASPVK VLSDKITQIYSDIKHLADIAGIDVPDTSLPNSASVEQIQNKMQELNDLLEELRESFDGYL GGNAFANQIQLNFVMPQQAQQQGQGQQQQAQATAQEAVAAAAVRLLNGNDQIAQLYKDLV KLQRHAGIKKAMEKLAAQQEEDAKNQGEGDCKQQQGTSEKSKKGKDKEAEFDLSMIVGQV KLYADVMITESVSIYAGVGAGLAYTSGKIDNKDIKGHTGMVASGALGVAINAAEGVYVDI EGSYMYSFSKIEEKYSINPLMASVSVRYNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NFYB (Nuclear Transcription Factor Y, beta, CBF-A, CBF-B, HAP3, NF-YB) (MaxLight 550)
MBS6218264-01 0.1 mL

NFYB (Nuclear Transcription Factor Y, beta, CBF-A, CBF-B, HAP3, NF-YB) (MaxLight 550)

Sign In for Pricing
View Details
NFYB (Nuclear Transcription Factor Y, beta, CBF-A, CBF-B, HAP3, NF-YB) (MaxLight 550)
MBS6218264-02 5x 0.1 mL

NFYB (Nuclear Transcription Factor Y, beta, CBF-A, CBF-B, HAP3, NF-YB) (MaxLight 550)

Sign In for Pricing
View Details
P4HTM, Recombinant, Human, aa82-563, His-SUMO-Tag (Transmembrane Prolyl 4-hydroxylase)
374590-01 20 µg

P4HTM, Recombinant, Human, aa82-563, His-SUMO-Tag (Transmembrane Prolyl 4-hydroxylase)

Sign In for Pricing
View Details
P4HTM, Recombinant, Human, aa82-563, His-SUMO-Tag (Transmembrane Prolyl 4-hydroxylase)
374590-02 100 µg

P4HTM, Recombinant, Human, aa82-563, His-SUMO-Tag (Transmembrane Prolyl 4-hydroxylase)

Sign In for Pricing
View Details
P4HTM, Recombinant, Human, aa82-563, His-SUMO-Tag (Transmembrane Prolyl 4-hydroxylase)
374590-03 1 mg

P4HTM, Recombinant, Human, aa82-563, His-SUMO-Tag (Transmembrane Prolyl 4-hydroxylase)

Sign In for Pricing
View Details
Rabbit Polyclonal DOCK10 Antibody [Janelia Fluor 549]
NB100-60670JF549 0.1 mL

Rabbit Polyclonal DOCK10 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details