Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli Protein Rtn (rtn)

This Recombinant Escherichia coli Protein Rtn (rtn) spans the amino acid sequence from region 1-518.

Product Specifications

Product Name Alternative

Protein Rtn

UniProt

P76446

Expression Region

1-518

Origin

Escherichia coli (strain K12)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFIRAPNFGRKLLLTCIVAGVMIAILVSCLQFLVAWHKHEVKYDTLITDVQKYLDTYFAD LKSTTDRLQPLTLDTCQQANPELTARAAFSMNVRTFVLVKDKKTFCSSATGEMDIPLNEL IPALDINKNVDMAILPGTPMVPNKPAIVIWYRNPLLKNSGVFAALNLNLTPSLFYSSRQE DYDGVALIIGNTALSTFSSRLMNVNELTDMPVRETKIAGIPLTVRLYADDWTWNDVWYAF LLGGMSGTVVGLLCYYLMSVRMRPGREIMTAIKREQFYVAYQPVVDTQALRVTGLEVLLR WRHPVAGEIPPDAFINFAESQKMIVPLTQHLFELIARDAAELEKVLPVGVKFGINIAPDH LHSESFKADIQKLLTSLPAHHFQIVLEITERDMLKEQEATQLFAWLHSVGVEIAIDDFGT GHSALIYLERFTLDYLKIDRGFINAIGTETITSPVLDAVLTLAKRLNMLTVAEGVETPEQ ARWLSERGVNFMQGYWISRPLPLDDFVRWLKKPYTPQW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit
MBS7258121-01 48 Well

Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit
MBS7258121-02 96 Well

Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit
MBS7258121-03 5x 96 Well

Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit

Sign In for Pricing
View Details
Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit
MBS7258121-04 10x 96 Well

Guinea Pig Secreted Frizzled-Related Protein 3 (FRZB) ELISA Kit

Sign In for Pricing
View Details
RBFOX1 sgRNA CRISPR Lentivector (Human) (Target 1)
K2798802 1.0 µg DNA

RBFOX1 sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Complete Medium for BT-549 Cells
abx703142 500 mL

Complete Medium for BT-549 Cells

Sign In for Pricing
View Details