Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Nucleolar complex protein 4 homolog (noc4l)

This Recombinant Danio rerio Nucleolar complex protein 4 homolog (noc4l) spans the amino acid sequence from region 1-525.

Product Specifications

Product Name Alternative

Nucleolar complex protein 4 homolog, NOC4 protein homolog, NOC4-like protein, Nucleolar complex-associated protein 4-like protein

UniProt

Q4VBT2

Expression Region

1-525

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAPSGDSNVKEHNNQVSYKKAINTKTDLILQNKKHANDIFDVIEYLQSEKEKEIIFATNA CSKIFCELIERGDLFVGELPKEEDLAQGDRSAEEKYHIFMRHRYNSCVELMLENVSHESF QVKETSLCAVMKFVATEGKHPLQNLDWSEHYNFPRELIQALVEHLLSEKEDMSLLISRFQ EFMEKDDVRYYVMSSVRYSTATVMERNKKAVIPVFQNNVFNLLTTINIPNQASEMTNFLV QQQSKHDDWKAAKLKEHKRAFEQMWLLFLRYKLPGSMYKKILVILHESILPQMSDPKLMM DFLSAAYDIGGAISLSALNGLFVPIHEHNLDYPDFYKKLYNLLDPSIFHVKYRARFFHLA NIFLSSTHLPVYLVAAFVKRLARLSLTAPPTALLILLPFICNLIRRHPSCRVLIHRPSAA DEPCDDPYVMEEEDPAQCHALESSLWEIKTLQNHHHPDVSKAATMINEPLSAQEEDISEL LELTTFELMERELKGEKKTVPLEFDMATDLLKSSREVLGVHFTLE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL
BNC470253-100 1x 100 µL

Cytokeratin, LMW (AE-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL
BNC940965-500 1x 500 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
BNC471037-500 1x 500 µL

CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL
BNC681231-100 1x 100 µL

Eosinophil Peroxidase (AHE-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL
BNC740158-100 1x 100 µL

Cytokeratin 17 (E3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL
BNC140017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF514 conjugate, 0.1mg/mL

Sign In for Pricing
View Details