Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Equine herpesvirus 1 Envelope glycoprotein E (gE)

This Recombinant Equine herpesvirus 1 Envelope glycoprotein E (gE) spans the amino acid sequence from region 24-550.

Product Specifications

Product Name Alternative

Envelope glycoprotein E, gE

UniProt

P68328

Expression Region

24-550

Origin

Equine herpesvirus 1 (strain AB1) (EHV-1) (Equine abortion virus)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

VQQVELSEGAWAMIDGRDVLTPTNTTTRVTKAWTFLETPPGCAGDISVKKVCVSHSLCED NIIIGKHCNLLTGEHGIALAEFNVVNGSLRRTDDVYFVNGTVFPILAETRSVLQIHRATP SIAGVYTLHVSIDGMMKHSVVLLTVKKPPKQPQPRLRVKTPPPVTVPQVPVKTHTDFVVH GYHSRVYADGESFELSVNLESHIVEPSFSAEIQWYYMNTSSSSCDLFRVFETCIFHPTAM ACLHPEQHTCSFTSPIRATKILHRVYGNCSDHGNSWPSRCHSTLLGNRLYFIQPAQNRVD LLFKDTPASATGLYVFVLLYNGHPEAWTYTLLSTANHFMNVLTDVTRPRLGEHFYTDLGH KIITPHPSVATTEELGAWTRHYLAFLLVIICTCAALLVALVVWGCILYIRSNRKPYEVLN PFETVYTSVPSNDPSDEVLVFERLASDSDDSFDSDSDEELEYPPPPKPAPQLPPYQFVDG GDAPSGRSGFKVWFRDTPEASPVPLHKPTLQGPDYSRVASKLKSILK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HSPA7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0998305 3x 1.0 µg

HSPA7 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein (S100)
MBS2003565-01 0.1 mL

Polyclonal Antibody to S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein (S100)
MBS2003565-02 0.2 mL

Polyclonal Antibody to S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein (S100)
MBS2003565-03 0.5 mL

Polyclonal Antibody to S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein (S100)
MBS2003565-04 1 mL

Polyclonal Antibody to S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details
Polyclonal Antibody to S100 Calcium Binding Protein (S100)
MBS2003565-05 5 mL

Polyclonal Antibody to S100 Calcium Binding Protein (S100)

Sign In for Pricing
View Details