Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Uncharacterized aarF domain-containing protein kinase 4 (Adck4)

This Recombinant Mouse Uncharacterized aarF domain-containing protein kinase 4 (Adck4) spans the amino acid sequence from region 1-533.

Product Specifications

Product Name Alternative

Uncharacterized aarF domain-containing protein kinase 4, EC= 2.7.11.-

UniProt

Q566J8

Expression Region

1-533

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLELGAMLRRTCGPLGRAVRLPCGGALGPRPHWWGPCRSCLAQSVHQDQPGRGLSEDDI RRAREARLRKAPRPQLSDRSRERKVPASRISRLASFGGLAVGLGLGALAEVTKKSLPGGS LQHEGVSGLGSSPFLSEANAERIVQTLCTVRGAALKIGQMLSIQDNSFISPQLQRIFERV RQSADFMPRWQMMRVLEEELGKDWQDKVASLEEVPFAAASIGQVHQGLLKDGTEVAVKIQ YPGVAQSIQSDVENLLALLKMSVGLPEGLFAEQSLQTLQQELAWECDYRREAACAQTFRK LLADDPFFRVPAVVQELCTTRVLGMELAGGIPLDQCQGLSQDIRNQICFQLLRLCLRELF EFRFMQTDPNWANFLYDASSHQVTLLDFGASRAFGTEFTDHYIEVVKAAADGDRDRVLQK SQDLKFLTGFETKAFSDAHVEAVMILGEPFAASGPYDFGAGETARRIQGLIPVLLRHRLR PPPEETYALHRKLAGAFLACARLHAHIACRDLFQDTYHRYWASRQTLPLPAAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)
MBS1412219-01 0.02 mg (E-Coli)

Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)

Sign In for Pricing
View Details
Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)
MBS1412219-02 0.1 mg (E-Coli)

Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)

Sign In for Pricing
View Details
Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)
MBS1412219-03 0.02 mg (Yeast)

Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)

Sign In for Pricing
View Details
Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)
MBS1412219-04 0.1 mg (Yeast)

Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)

Sign In for Pricing
View Details
Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)
MBS1412219-05 0.02 mg (Baculovirus)

Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)

Sign In for Pricing
View Details
Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)
MBS1412219-06 0.02 mg (Mammalian-Cell)

Recombinant Rat RAD9, RAD1, HUS1-interacting nuclear orphan protein (Rhino)

Sign In for Pricing
View Details