Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Peroxisomal membrane protein pex32 (pex32)

This Recombinant Schizosaccharomyces pombe Peroxisomal membrane protein pex32 (pex32) spans the amino acid sequence from region 1-535.

Product Specifications

Product Name Alternative

Peroxisomal membrane protein pex32, Peroxin-32

UniProt

O59807

Expression Region

1-535

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIRAHLFSEPDNSKLWAKSTGSDAFDLILKVLLWTAPWYYCLTTLFFTWLIILYPRPTLA CSVAAWLFWFTSLDTLEPDDRKNTLKASEAVSTSAKTSEETAKPSETREDGEWNTLKNTL EADAQNLMSGFQMLQRRWSQPKTTTLKTEVKEQQASQSPSVEGENEPAGVKSNEATKPSV TEEKEKNAEQNKRRERLSISHIVTELAKKDEVSSESGSNEIVNAKLKNEQLDSNFTLLDA YLEPLVHLHEYSRRSNTLFFFYLPIVMSILIFCLPTQALFIVLSSVFLAWHSPPLQAVLF CIRRISFFNLLYEKFVIGKTKEPAKPVPQPSSNEPPAPSAENKQPSVSSPEKKESPATHL LKVIGSSPYVVHSNHTNNTLTDKESSDPTEKCLYLIEHQRYWVGVGWLNRTLPTDPPNFT NAGSTDPVAEPTAQLLPPDGLAWIDDKWSISPWTFTDTFWAQPAKTQFRTAFTRSREWRR RYRVAPPAENEKPHTSRTNTASSLSSTSEDQVSTHGSISSAKVTAIPDSNGAEAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL
BNC740630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF640R conjugate, 0.1mg/mL
BNC400164-100 1x 100 µL

CD28 (204.12), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL
BNC740669-500 1x 500 µL

P27 / KIP1 (SX53G8), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-100 1x 100 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF405S conjugate, 0.1mg/mL
BNC042338-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/2338R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 / ICAM3 (ICAM3/2873R), CF568 conjugate, 0.1mg/mL
BNC682873-500 1x 500 µL

CD50 / ICAM3 (ICAM3/2873R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details