Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 (lrit2)

This Recombinant Danio rerio Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2 (lrit2) spans the amino acid sequence from region 22-561.

Product Specifications

Product Name Alternative

Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 2

UniProt

Q504C1

Expression Region

22-561

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ECFPGCSCGTDRHGRSLTCMETALTGIPDGLPEDLTKIRIEKSQLSELPEAVFSHVKALK HLWLNFNDIAIINIKSLEGLANLTELRLQGNKLRSVPWTAFEETPNLKILDLKHNRIDAL PEHALKFLPGLTYLDLSSNQLSVISKDVFLNWPLYHSENKHEKPSASNVVLALHDNPWLC DCRLGGFIEFIKSLTPPFILMNSYLTCSSPELKAGRFFHEVDLKTCVKPVVSAPVITITA PLGGNVTLTCSASARPEAVIRWIYALKMLRGFRDILSHVDEDTISSQLVIPSLHSADRGL YTCIANNFLGNSSVIISVDVKSPEGSSSHPSGPSAAIGEENVYIDIRIAKQTVYGITIEW RAVTENPAETWFTIHFGRYDAVKKEQIYIGPGINTYSVTDLLPATKYEICVTLKNQAPRI GQCIVFVTGSDFNEMEQREKLIHIVVIVLAMVLAVPAGMYACTTDAKFNCFERCAELWRN RRHAELSNPTGDRQGTFDSLQAASDEGLYKESNKDKKARRRSAEKIHKTKNDRRPTAELY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF647 conjugate, 0.1mg/mL
BNC470160-100 1x 100 µL

CD20 (B9E9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL
BNC470181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL
BNC040460-500 1x 500 µL

CD44 Standard (156-3C11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL
BNC040391-100 1x 100 µL

CD81 / TAPA-1 (1.3.3.22), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details