Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Kluyveromyces lactis Mitochondrial distribution and morphology protein 32 (MDM32)

This Recombinant Kluyveromyces lactis Mitochondrial distribution and morphology protein 32 (MDM32) spans the amino acid sequence from region 44-583.

Product Specifications

Product Name Alternative

Mitochondrial distribution and morphology protein 32

UniProt

Q6CUA4

Expression Region

44-583

Origin

Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) (Yeast) (Candida sphaerica)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ATEKHDMDELNKSTDYMHIQNILLQKEKELSTKHTLLKEATGFYDRFKINTKWFLIRGNR PFSFDELSTLFSWLIISQIIWVILGTTTFVSLVLFTFNTVFAKEMVGKFVGNTLNKYIDS CDVEFQDALVPEWKKGCIRFRSVKVRTVTDGKSDVPSDQLQFDLKFNQVDITLSVRKWMT GHGLIDNLTVLGMHGKVVLNDVNENKLVGWFSNPEYHLGAVKVCDSCFTLRDGNQDYRIS IYNMDMNRLRFEWCVSDFFNANVVTGAINHSLFTIHKRQHKLAYLQDLEKDLSPWKRITR LRLDRISVKDLGLDKSSSFNWIEEGSVEIIADLMLPNVEDESQDSDEEKNNKYMVMDLKF NFRDLKAKFPESAPTLSNGETVISFDELKPIINYINNRRVIFNSVATTETIDPDWNRITP VSIKRQKSYPDTTVIPTSVTWPDGEDEVQINKEIIKYHDQPTTNTNNLILKCRIVKNIDE LQNVALFRESGVYDVLAMELYVDLMKIVEEWEFKKKNSWMRLWGTTLASQLLIFGLGAMV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL
BNC940181-100 1x 100 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-500 1x 500 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-100 1x 100 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863), CF568 conjugate, 0.1mg/mL
BNC680863-100 1x 100 µL

Glypican-3 (GPC3/863), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF488A conjugate, 0.1mg/mL
BNC881274-100 1x 100 µL

Cytokeratin 10 (Suprabasal Epithelial Marker) (AE20), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF568 conjugate, 0.1mg/mL
BNC681976-500 1x 500 µL

CD27 (Tumor Necrosis Factor Receptor Superfamily 7) (rLPFS2/1611), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details