Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rat Atlastin-3 (Atl3)

This Recombinant Rat Atlastin-3 (Atl3) spans the amino acid sequence from region 1-541.

Product Specifications

Product Name Alternative

Atlastin-3, EC= 3.6.5.-

UniProt

Q0ZHH6

Expression Region

1-541

Origin

Rattus norvegicus (Rat)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLSPQRTAAVASRGAGDAMENGKPGPVQVVLVHKEQHSFELEERALASVLLQDHIRDLDV VVVSVAGAFRKGKSFILDFMLRYLYSQKEHGHSNWLGDPEEPLTGFSWRGGSDPETTGIQ IWSEVFTVKKPCGKEVAVVLMDTQGAFDSQSTVKDCATIFALSTMTSSVQIYNLSQNIQE DDLQQLQLFTEYGRLAMDEIFQKPFQTLMFLVRDWSFPYEYNYGLQGGMSFLDKRLQVKE HQHEEIQNVRNHIHSCFSDVTCFLLPHPGLQVATSPDFDGKLKEYIASEFKEQLQTLIPY VLNPSKLMEKEINGSKVTCRGLLEYFKAYIKIYQGEDLPHPKSMLQATAANNLAAAASAK DIYYSSMEEICGGEKPYLSPDILEEKHQEFKQLALDHFKKTKKMGGKDFSFRYQQELEEE ITELYENFCKHNGSKNVFSTFRTPAVLFTGIAVLYIASGLTGFIGLEVVAQLFNCMVGLL LIALLTWGYIRYSGQYLELGGAIDSGAAYVLEQASSHIGNSTQAAVRDAIAGRPPADKKS Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Interleukin 32R (IL-32R) ELISA Kit
YP-W10368-01 48 Tests

Human Interleukin 32R (IL-32R) ELISA Kit

Sign In for Pricing
View Details
Human Interleukin 32R (IL-32R) ELISA Kit
YP-W10368-02 96 Tests

Human Interleukin 32R (IL-32R) ELISA Kit

Sign In for Pricing
View Details
SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) APC
MBS6394092-01 0.1 mL

SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) APC

Sign In for Pricing
View Details
SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) APC
MBS6394092-02 5x 0.1 mL

SH2D2A (SH2 Domain-containing Protein 2A, SH2 Domain-containing Adapter Protein, T Cell-specific Adapter Protein, TSAd, VEGF Receptor-associated Protein, SCAP, TSAD, VRAP) APC

Sign In for Pricing
View Details
TBCA protein
30R-1333 0.1 mg

TBCA protein

Sign In for Pricing
View Details
3-Amino-5-carbamoylbenzoic acid
HFA64026-01 50 mg

3-Amino-5-carbamoylbenzoic acid

Sign In for Pricing
View Details