Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable elastin-binding protein ebpS (ebpS)

This Recombinant Staphylococcus saprophyticus subsp. saprophyticus Probable elastin-binding protein ebpS (ebpS) spans the amino acid sequence from region 1-541.

Product Specifications

Product Name Alternative

Probable elastin-binding protein ebpS

UniProt

Q49XT4

Expression Region

1-541

Origin

Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSNNNFKDDFEKNRQSIDPKEHQENTQDSVNDSVDNIKEEVSDKSDEQFPPRNAQRRQRR RDTATNQREDEQSNQEHHNENNEVGDRDNGLQHEDNSSRDSNADKESNDPSQNNNLIHES SNNQQSENRHDINNEKDQSDKDSNNKKGAVIASSGAAGVGAYAASKHNDAASSSKDHNDK AHQQNQDWEQSNQTNDSTETQDENTNNHDSKKKGAAVAGGAAAAGAGAYAAGKHKGKKDK NDNEPEQNESKSDVKNEEKHGSKKKGAAVAGGAAAAGTGAAAASHSKSSTGNGGNGNGGN GGNGNNGDNNHDSEDNNKKKGGLLGKLLPIIAAILILAAIGIFGGMALTGNNDDKGSDDD KKVADNKDKDSDKAKDADSDKDSKSDKDKDKAKDDDNNQATTDSDSSDSSDNANSDSDQG NNDSQDQANSDQNQGTQDEQNSQNNQDQQSDQSQQNGQANSNQNGSSDQSQNASNDSNQQ NNQSSNSNSGQRTHVVNGQNLYRIAIQYYGEGTPENVEKIREANNIQGNDIHNGQRLVIP Q

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)
CSB-EP3325GMY(M18)a0-01 10 µg

Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)

Sign In for Pricing
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)
CSB-EP3325GMY(M18)a0-02 50 µg

Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)

Sign In for Pricing
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)
CSB-EP3325GMY(M18)a0-03 200 µg

Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)

Sign In for Pricing
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)
CSB-EP3325GMY(M18)a0-04 500 µg

Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)

Sign In for Pricing
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)
CSB-EP3325GMY(M18)a0-05 100 µg

Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)

Sign In for Pricing
View Details
Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)
CSB-EP3325GMY(M18)a0-06 1 mg

Recombinant Severe acute respiratory syndrome coronavirus 2 Nucleoprotein (N) (P13L, 31-33:ERS→Missing, R203K, G204R)

Sign In for Pricing
View Details