Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse WSC domain-containing protein 1 (Wscd1)

This Recombinant Mouse WSC domain-containing protein 1 (Wscd1) spans the amino acid sequence from region 1-572.

Product Specifications

Product Name Alternative

WSC domain-containing protein 1

UniProt

Q80XH4

Expression Region

1-572

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAKPFFRLQKFLRRTQFLLLFLTAAYLMTGSLLLLQRARVALPQALRAPGSLQALPVATV ALGVGLLDGRSLRDPHSSPDLLLDVDTLRSPLARLPPGIRWPRRNRSSLRRRWLHHLTSD PQGPPTLSPEASGPANHNRGNYLGCFSEEGQERTLKGAVFYDLRKMTVSHCQDACAERSY VYAGLEAGAECYCGNRLPATRVSLKECNQECKGEKGSMCGAVRRLSVYSVGLQQPGSKKR RTATYRGCFPLPENVTHTFSSSMTQANMTVETCSGFCSQKEFPLAILRGWDCYCAYPTPQ FSLRDAVDGALCSQAPETQGLPGYCEVYQTPVQDTRCTDRKFLPDKSKVFVALSSFPGAG NTWARHLIEHATGFYTGSYYFDGTLYNKGFKGEKDHWRSRRTICVKTHESGRREIEMFDS AILLIRNPYRSLVAEFNRKCAGHLGYAPDRNWKSKEWPEFVNSYASWWSSHVLDWLKYGK RLLVVHYEELRHSLVPTLREMVAFLNVSVSEERLLCVENNKEGSFRRRGRRPHDQEPFTP EMKDLINGYIRTVDQALRDHNWAGLPREYVPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DZIP1 Double Nickase Plasmid (h)
sc-406925-NIC 20 µg

DZIP1 Double Nickase Plasmid (h)

Sign In for Pricing
View Details
CNOT1 Recombinant Protein Antigen
NBP2-31892PEP 0.1 mL

CNOT1 Recombinant Protein Antigen

Sign In for Pricing
View Details
TRAP1, CT (TRAP1, HSP75, Heat shock protein 75kD, mitochondrial, TNFR-associated protein 1, Tumor necrosis factor type 1 receptor-associated protein)
MBS646110-01 0.2 mL

TRAP1, CT (TRAP1, HSP75, Heat shock protein 75kD, mitochondrial, TNFR-associated protein 1, Tumor necrosis factor type 1 receptor-associated protein)

Sign In for Pricing
View Details
TRAP1, CT (TRAP1, HSP75, Heat shock protein 75kD, mitochondrial, TNFR-associated protein 1, Tumor necrosis factor type 1 receptor-associated protein)
MBS646110-02 5x 0.2 mL

TRAP1, CT (TRAP1, HSP75, Heat shock protein 75kD, mitochondrial, TNFR-associated protein 1, Tumor necrosis factor type 1 receptor-associated protein)

Sign In for Pricing
View Details
Human DHCR24 Ab Elisa Kit
EK710815 96 Well

Human DHCR24 Ab Elisa Kit

Sign In for Pricing
View Details
DEPTOR (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPDC6) (HRP)
MBS6269488-01 0.1 mL

DEPTOR (DEP Domain-containing mTOR-interacting Protein, DEP Domain-containing Protein 6, DEPDC6) (HRP)

Sign In for Pricing
View Details