Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Danio rerio WSC domain-containing protein 2 (wscd2)

This Recombinant Danio rerio WSC domain-containing protein 2 (wscd2) spans the amino acid sequence from region 1-572.

Product Specifications

Product Name Alternative

WSC domain-containing protein 2

UniProt

A2BGL3

Expression Region

1-572

Origin

Danio rerio (Zebrafish) (Brachydanio rerio)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MARSLLKIHRYFRRKPVRFFSFILLYLTAGSLVFLHSGFSSDSSTAGIAGSGSDPLLSEG RGGTGGGSATSEGLGLLGRVFKETRRTPRRFGPPWMKESRGQDAPEWAGRGFDHTSSWSH GAKGRTTKEMDDGRAKYIGCYVDDTQKRALRGVSFLDYKKMTVFRCQDNCAERGYLYAGL EFGAECYCGHKIQAPNVSESECNMECKGEKSNLCGGPNRLSIYRLELSQESARRYGSAIF KGCFRRPDNVTLALPASAVMQNMSVDKCVDMCTEKEFSLAALAGDKCHCGFPTPLFNLHE HEDEELCLHRCTGEDFESCGNRDFFVVYQTQVQDNRCMDRRFLPTRSKHLMALASFPGAG NTWARHLIELATGYYTGSYYFDGSLYNKGFKGERDHWRSGRTICIKTHESGKKEIETFDA SILMIRNPYKALMAEFNRKYGGHIGFASQAHWRGKEWPEFVKNYAPWWASHTLDWLKYGK KVQVVHFEDLKRDLFSQLKGMVIFLGLEVSEDRLLCVEGQKDGNFKRSGLRKLEYDPYTV EMRATIDRLIKTVDMELRKRNLSGVPDEYRPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nefh sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K6860607 1.0 µg DNA

Nefh sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate
AL1025A-01 500 mL

Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate
AL1025A-02 2x 500 mL

Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate
AL1025A-03 6x 500 mL

Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate

Sign In for Pricing
View Details
Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate
AL1025A-04 20x 500 mL

Nutrient Mixture F-12 Ham w/ L-Glutamine and 1.176gms per litre Sodium bicarbonate

Sign In for Pricing
View Details
ADCK1 (Uncharacterized aarF Domain-Containing Protein Kinase 1, 2711-, ADCK1) (AP)
MBS6454006-01 0.1 mL

ADCK1 (Uncharacterized aarF Domain-Containing Protein Kinase 1, 2711-, ADCK1) (AP)

Sign In for Pricing
View Details