Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yellow fever virus Genome polyprotein

This Recombinant Yellow fever virus Genome polyprotein spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Genome polyproteinCleaved into the following 7 chains: 1. Capsid protein C Core protein prM Peptide pr Small envelope protein M Matrix protein Envelope protein E Non-stru

UniProt

P29165

Expression Region

1-101

Origin

Yellow fever virus (isolate Peru/1899/1981) (YFV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGRKAQGKTLGVNMVRQGVRSLSNKIKQKTKQIGNRPGPSRGVQGFIFFFLFNVLTGRK ITAHLKKLWRMLDPRQGLAVLKKVKRVVASLMRGLSSRKRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRNAL35 AAV siRNA Pooled Vector
48174161 1.0 µg

TRNAL35 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
Anti-TrpM6 Antibody FL490 Conjugate
75-464-FL490 200 µL

Anti-TrpM6 Antibody FL490 Conjugate

Sign In for Pricing
View Details
Mouse Monoclonal GRID1 Antibody (1A9)
H00002894-M01 0.1 mg

Mouse Monoclonal GRID1 Antibody (1A9)

Sign In for Pricing
View Details
Anti-IL-6 Monoclonal Antibody
M00102-1 100 µg

Anti-IL-6 Monoclonal Antibody

Sign In for Pricing
View Details
Mouse Monoclonal Cytokeratin 5/8 Antibody (SPM268) - Azide and BSA Free
NBP2-47823-0.1mg 0.1 mg

Mouse Monoclonal Cytokeratin 5/8 Antibody (SPM268) - Azide and BSA Free

Sign In for Pricing
View Details
Cadherin-16 (M810) polyclonal antibody
BS2221 50ul

Cadherin-16 (M810) polyclonal antibody

Sign In for Pricing
View Details