Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yellow fever virus Genome polyprotein

This Recombinant Yellow fever virus Genome polyprotein spans the amino acid sequence from region 1-101.

Product Specifications

Product Name Alternative

Genome polyproteinCleaved into the following 7 chains: 1. Capsid protein C Core protein prM Peptide pr Small envelope protein M Matrix protein Envelope protein E Non-stru

UniProt

P29165

Expression Region

1-101

Origin

Yellow fever virus (isolate Peru/1899/1981) (YFV)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGRKAQGKTLGVNMVRQGVRSLSNKIKQKTKQIGNRPGPSRGVQGFIFFFLFNVLTGRK ITAHLKKLWRMLDPRQGLAVLKKVKRVVASLMRGLSSRKRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAFI HDR Plasmid (h)
sc-416317-HDR 20 µg

TAFI HDR Plasmid (h)

Sign In for Pricing
View Details
ER Lumen Protein-Retaining Receptor 1 (KDEL) Antibody
abx216400-01 50 µg

ER Lumen Protein-Retaining Receptor 1 (KDEL) Antibody

Sign In for Pricing
View Details
ER Lumen Protein-Retaining Receptor 1 (KDEL) Antibody
abx216400-02 100 µg

ER Lumen Protein-Retaining Receptor 1 (KDEL) Antibody

Sign In for Pricing
View Details
XFD750 Anti-human CD109 Antibody *W7C5*
110901A1-AAT 500 Tests

XFD750 Anti-human CD109 Antibody *W7C5*

Sign In for Pricing
View Details
Human FAM50B knockout cell line
ABC-KH5263 1 Vial

Human FAM50B knockout cell line

Sign In for Pricing
View Details
TFIIA2 (GTF2A2) (NM_004492) Human Tagged Lenti ORF Clone
RC201117L4 10 µg

TFIIA2 (GTF2A2) (NM_004492) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details