Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis Multidrug resistance protein EbrA (ebrA)

This Recombinant Bacillus licheniformis Multidrug resistance protein EbrA (ebrA) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Multidrug resistance protein EbrA

UniProt

Q65JB1

Expression Region

1-105

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIAGYIFLLIAILSEAAAAAMLKISDGFARWQPSVLVVIGYGLAFYMMSLTLQVIPLSLS YATWSGAGTVLTAIIGVLWFQEKLNRRNIAGIICLVSGVVLINLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Mouse MHC Class II (M5/114.15.2) In Vivo Antibody - Low Endotoxin
ICH1176-5mg 5 mg

Anti-Mouse MHC Class II (M5/114.15.2) In Vivo Antibody - Low Endotoxin

Sign In for Pricing
View Details
Progesterone Receptor (PR484), CF640R conjugate, 0.1mg/mL
BNC400484-100 1x 100 µL

Progesterone Receptor (PR484), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
PD-L2 Mouse Monoclonal Antibody [A10D8]
HA601331 100 µL

PD-L2 Mouse Monoclonal Antibody [A10D8]

Sign In for Pricing
View Details
2,5-Anhydro-3,4-dibenzyl-D-glucitol
TRC-A637850-25MG 25 mg

2,5-Anhydro-3,4-dibenzyl-D-glucitol

Sign In for Pricing
View Details
VILIP1 (VSNL1) (NM_003385) Human Recombinant Protein
TP305337L 1 mg

VILIP1 (VSNL1) (NM_003385) Human Recombinant Protein

Sign In for Pricing
View Details
MAN1 (LEMD3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H1]
TA500796BM 100 µL

MAN1 (LEMD3) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3H1]

Sign In for Pricing
View Details