Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis Multidrug resistance protein EbrA (ebrA)

This Recombinant Bacillus licheniformis Multidrug resistance protein EbrA (ebrA) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Multidrug resistance protein EbrA

UniProt

Q65JB1

Expression Region

1-105

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIAGYIFLLIAILSEAAAAAMLKISDGFARWQPSVLVVIGYGLAFYMMSLTLQVIPLSLS YATWSGAGTVLTAIIGVLWFQEKLNRRNIAGIICLVSGVVLINLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Pgk1, Recombinant, Mouse, aa1-4170, His-Tag (Phosphoglycerate kinase 1)
350167-01 100 µg

Pgk1, Recombinant, Mouse, aa1-4170, His-Tag (Phosphoglycerate kinase 1)

Sign In for Pricing
View Details
Pgk1, Recombinant, Mouse, aa1-4170, His-Tag (Phosphoglycerate kinase 1)
350167-02 500 µg

Pgk1, Recombinant, Mouse, aa1-4170, His-Tag (Phosphoglycerate kinase 1)

Sign In for Pricing
View Details
BFAR Protein Vector (Mouse) (pPM-C-His)
PV159341 500 ng

BFAR Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Anti-RASAL1 antibody
STJ117308 100 µl

Anti-RASAL1 antibody

Sign In for Pricing
View Details
SYNGAP1 antibody
70R-20665 50 μL

SYNGAP1 antibody

Sign In for Pricing
View Details
GABRR1 Antibody
MBS7043855-01 0.05 mL

GABRR1 Antibody

Sign In for Pricing
View Details