Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus licheniformis Multidrug resistance protein EbrA (ebrA)

This Recombinant Bacillus licheniformis Multidrug resistance protein EbrA (ebrA) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Multidrug resistance protein EbrA

UniProt

Q65JB1

Expression Region

1-105

Origin

Bacillus licheniformis (strain DSM 13 / ATCC 14580)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIAGYIFLLIAILSEAAAAAMLKISDGFARWQPSVLVVIGYGLAFYMMSLTLQVIPLSLS YATWSGAGTVLTAIIGVLWFQEKLNRRNIAGIICLVSGVVLINLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Versican Recombinant Antibody, RBITC Conjugated
bsm-63236R-RBITC 100 µL

Versican Recombinant Antibody, RBITC Conjugated

Sign In for Pricing
View Details
Rods, Glass, Stirring
2067840/C 1 Each

Rods, Glass, Stirring

Sign In for Pricing
View Details
Anti-CCL11 (BeRoom Temperatureilimumab)-SMCC-DM1 ADC
ADC-W-746 1 mg

Anti-CCL11 (BeRoom Temperatureilimumab)-SMCC-DM1 ADC

Sign In for Pricing
View Details
Lentiviral mouse Spin4 shRNA (UAS) - Lentiviral mouse Spin4 shRNA (UAS, iRFP) (25)
GTR15278654 1 Vial

Lentiviral mouse Spin4 shRNA (UAS) - Lentiviral mouse Spin4 shRNA (UAS, iRFP) (25)

Sign In for Pricing
View Details
6-Chloro-3-pyridinecarboxamide
438355-01 5 g

6-Chloro-3-pyridinecarboxamide

Sign In for Pricing
View Details
6-Chloro-3-pyridinecarboxamide
438355-02 25 g

6-Chloro-3-pyridinecarboxamide

Sign In for Pricing
View Details