Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Quaternary ammonium compound-resistance protein sugE (sugE)

This Recombinant Quaternary ammonium compound-resistance protein sugE (sugE) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Quaternary ammonium compound-resistance protein sugE

UniProt

Q6PT90

Expression Region

1-105

Origin

Salmonella typhimurium

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSWIVLLIAGLLEVVWAIGLKYTHGFTRLTPSIITIAAMIVSIAMLSWAMRTLPVGTAYA VWTGIGAVGAAITGILLLGESASPARLLSLGLIVAGIIGLKLSTH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF405S conjugate, 0.1mg/mL
BNC040322-100 1x 100 µL

CD3e (RIV9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL
BNC470633-500 1x 500 µL

Von Willebrand Factor (3E2D10), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF568 conjugate, 0.1mg/mL
BNC680176-500 1x 500 µL

CD5 (Cris-1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL
BNC042311-500 1x 500 µL

SOX10 (Melanoma Marker) (SOX10/2311R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF647 conjugate, 0.1mg/mL
BNC472959-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2959), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF488A conjugate, 0.1mg/mL
BNC882563-500 1x 500 µL

GAD1 / GAD67 (GABAergic Neuronal Marker) (GAD1/2563), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details