Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance protein EbrA (ebrA)

This Recombinant Multidrug resistance protein EbrA (ebrA) spans the amino acid sequence from region 1-105.

Product Specifications

Product Name Alternative

Multidrug resistance protein EbrA

UniProt

P0CW81

Expression Region

1-105

Origin

Bacillus atrophaeus

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLVGYIFLTIAICSESIGAAMLKVSDGFKKWKPSALVVIAYSLAFYMLSLTLNHIPLSLS YATWSGVGTVLTAVIGVKWFKEELNAKGLIGILLLISGVVLLNWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CD14 Antibody Picoband® (Dylight594 Conjugate)
A00137-Dylight594 100 µg

Anti-CD14 Antibody Picoband® (Dylight594 Conjugate)

Sign In for Pricing
View Details
APC Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283E-01 50 Tests

APC Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
APC Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283E-02 100 Tests

APC Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
APC Anti-Mouse CD90 Antibody[M5/49.4.1]
E-AB-F1283E-03 2x 100 Tests

APC Anti-Mouse CD90 Antibody[M5/49.4.1]

Sign In for Pricing
View Details
APOB (Apolipoprotein B, FLDB, LDLCQ4) (FITC)
MBS6188055-01 0.1 mL

APOB (Apolipoprotein B, FLDB, LDLCQ4) (FITC)

Sign In for Pricing
View Details
APOB (Apolipoprotein B, FLDB, LDLCQ4) (FITC)
MBS6188055-02 5x 0.1 mL

APOB (Apolipoprotein B, FLDB, LDLCQ4) (FITC)

Sign In for Pricing
View Details