Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Acinetobacter baumannii UPF0060 membrane protein ACICU_02019 (ACICU_02019)

This Recombinant Acinetobacter baumannii UPF0060 membrane protein ACICU_02019 (ACICU_02019) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ACICU_02019

UniProt

B2I2V0

Expression Region

1-107

Origin

Acinetobacter baumannii (strain ACICU)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFGLFIITAIAEILGCYFPYLILKEGKSAWLWLPTALSLAVFVWLLTLHPAASGRIYAAY GGIYIFTALMWLRFVDQVALTRWDILGGVIVLCGAGLIILQPQGLIR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL
BNC881081-500 1x 500 µL

CD45RO (190-2F2.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL
BNC042220-500 1x 500 µL

CD43 (T-Cell Marker) (rSPN/839), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL
BNC470918-500 1x 500 µL

CD44 Standard (HCAM/918), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL
BNC040226-100 1x 100 µL

Pmel17 / gp100 / SILV (NKI-beteb), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF488A conjugate, 0.1mg/mL
BNC881126-100 1x 100 µL

Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details