Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance protein mmr (mmr)

This Recombinant Multidrug resistance protein mmr (mmr) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Multidrug resistance protein mmr

UniProt

Q9CBP1

Expression Region

1-107

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYLFLFCAIFVEVVATTLLKSTEGFTRLVPTLACLAGYAVTFTLLALSISRGMKTDVAY ALWSAIGTAAIVLIAVLFLDSPVSVAKVVGVALIIVGVITLNLADAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1- (3,4-Difluorophenyl) -2-oxopyrrolidine-3-carboxylic acid
SQB41744-01 50 mg

1- (3,4-Difluorophenyl) -2-oxopyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
1- (3,4-Difluorophenyl) -2-oxopyrrolidine-3-carboxylic acid
SQB41744-02 0.5 g

1- (3,4-Difluorophenyl) -2-oxopyrrolidine-3-carboxylic acid

Sign In for Pricing
View Details
AT1 (AGTR1, AG2S, AGTR1A, AGTR1B, AT1, AT1AR, AT1B, AT1BR, AT2R1, AT2R1A, AT2R1B, HAT1R) discontinued
220891-01 50 µL

AT1 (AGTR1, AG2S, AGTR1A, AGTR1B, AT1, AT1AR, AT1B, AT1BR, AT2R1, AT2R1A, AT2R1B, HAT1R) discontinued

Sign In for Pricing
View Details
AT1 (AGTR1, AG2S, AGTR1A, AGTR1B, AT1, AT1AR, AT1B, AT1BR, AT2R1, AT2R1A, AT2R1B, HAT1R) discontinued
220891-02 100 µL

AT1 (AGTR1, AG2S, AGTR1A, AGTR1B, AT1, AT1AR, AT1B, AT1BR, AT2R1, AT2R1A, AT2R1B, HAT1R) discontinued

Sign In for Pricing
View Details
FBXL3 Antibody Blocking Peptide
orb1501174 500 µg

FBXL3 Antibody Blocking Peptide

Sign In for Pricing
View Details
ELAVL3
314644-01 50 µL

ELAVL3

Sign In for Pricing
View Details