Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance protein mmr (mmr)

This Recombinant Multidrug resistance protein mmr (mmr) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Multidrug resistance protein mmr

UniProt

Q9CBP1

Expression Region

1-107

Origin

Mycobacterium leprae

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAYLFLFCAIFVEVVATTLLKSTEGFTRLVPTLACLAGYAVTFTLLALSISRGMKTDVAY ALWSAIGTAAIVLIAVLFLDSPVSVAKVVGVALIIVGVITLNLADAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cleaved-PARP (Asp214) Blocking Peptide
MBS9618103-01 1 mg

Cleaved-PARP (Asp214) Blocking Peptide

Sign In for Pricing
View Details
Cleaved-PARP (Asp214) Blocking Peptide
MBS9618103-02 5x 1 mg

Cleaved-PARP (Asp214) Blocking Peptide

Sign In for Pricing
View Details
PDE4D3, Control Peptide (cAMP-specific 3',5'-cyclic Phosphodiesterase 4D, DPDE3, PDE43) discontinued
148311 100 µg

PDE4D3, Control Peptide (cAMP-specific 3',5'-cyclic Phosphodiesterase 4D, DPDE3, PDE43) discontinued

Sign In for Pricing
View Details
UMOD, ID (UMOD, Uromodulin, Tamm-Horsfall urinary glycoprotein, Uromodulin, secreted form) (PE) discontinued
043606-PE 200 µL

UMOD, ID (UMOD, Uromodulin, Tamm-Horsfall urinary glycoprotein, Uromodulin, secreted form) (PE) discontinued

Sign In for Pricing
View Details
Human SULT1A1 Protein Lysate
MBS8428060-01 0.02 mg

Human SULT1A1 Protein Lysate

Sign In for Pricing
View Details
Human SULT1A1 Protein Lysate
MBS8428060-02 5x 0.02 mg

Human SULT1A1 Protein Lysate

Sign In for Pricing
View Details