Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance protein mmr (mmr)

This Recombinant Multidrug resistance protein mmr (mmr) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Multidrug resistance protein mmr

UniProt

P69927

Expression Region

1-107

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAY ALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Frozen Tissue Sections, Rectum
CS505420 5x 5 µm

Frozen Tissue Sections, Rectum

Sign In for Pricing
View Details
Human CT47A10 activation kit by CRISPRa
GA118899 1 Kit

Human CT47A10 activation kit by CRISPRa

Sign In for Pricing
View Details
Mrps21 (NM_078479) Mouse Tagged ORF Clone
MG200200 10 µg

Mrps21 (NM_078479) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
AKR1B1 Polyclonal Antibody
E-AB-15911-01 20 µL

AKR1B1 Polyclonal Antibody

Sign In for Pricing
View Details
AKR1B1 Polyclonal Antibody
E-AB-15911-02 60 µL

AKR1B1 Polyclonal Antibody

Sign In for Pricing
View Details
AKR1B1 Polyclonal Antibody
E-AB-15911-03 120 µL

AKR1B1 Polyclonal Antibody

Sign In for Pricing
View Details