Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Multidrug resistance protein mmr (mmr)

This Recombinant Multidrug resistance protein mmr (mmr) spans the amino acid sequence from region 1-107.

Product Specifications

Product Name Alternative

Multidrug resistance protein mmr

UniProt

P69927

Expression Region

1-107

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIYLYLLCAIFAEVVATSLLKSTEGFTRLWPTVGCLVGYGIAFALLALSISHGMQTDVAY ALWSAIGTAAIVLVAVLFLGSPISVMKVVGVGLIVVGVVTLNLAGAH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Thumpd1 Mouse Gene Knockout Kit (CRISPR)
KN517548 1 Kit

Thumpd1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
GRIA1 Rabbit Polyclonal Antibody
TA371141 100 µL

GRIA1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Dibenzylfluorescein
TRC-D417405-5MG 5 mg

Dibenzylfluorescein

Sign In for Pricing
View Details
BDNF (NM_001143806) Human Over-expression Lysate
LY428352 100 µg

BDNF (NM_001143806) Human Over-expression Lysate

Sign In for Pricing
View Details
NOL4 (NM_001198546) Human Over-expression Lysate
LY434318 100 µg

NOL4 (NM_001198546) Human Over-expression Lysate

Sign In for Pricing
View Details
C21orf62 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B5]
TA808848AM 100 µL

C21orf62 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5B5]

Sign In for Pricing
View Details