Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mycobacterium smegmatis UPF0060 membrane protein MSMEG_3252 (MSMEG_3252)

This Recombinant Mycobacterium smegmatis UPF0060 membrane protein MSMEG_3252 (MSMEG_3252) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein MSMEG_3252

UniProt

A0QXC5

Expression Region

1-108

Origin

Mycobacterium smegmatis (strain ATCC 700084 / mc (2) 155)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVGKSVVLFVLAAVLEIGGAWLVWQGLREQRGWLWAGAGVIALGAYGFVAAFQPDANFGR VLAAYGGVFIAGSLLWGMIADGFRPDRWDVAGAAVALVGVGLIMYAPR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL
BNC400304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL
BNC940149-500 1x 500 µL

CD106 / VCAM1 (1.4C3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
DOG-1 (DOG1.1), CF647 conjugate, 0.1mg/mL
BNC470725-500 1x 500 µL

DOG-1 (DOG1.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
GFAP (GA-5), CF770 conjugate, 0.1mg/mL
BNC700167-100 1x 100 µL

GFAP (GA-5), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (T-Cell Marker) (UCHT1), CF488A conjugate, 0.1mg/mL
BNC882473-100 1x 100 µL

CD3e (T-Cell Marker) (UCHT1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF647 conjugate, 0.1mg/mL
BNC472038-500 1x 500 µL

Gp100 / Melanosome / PMEL17 / SILV (Melanoma Marker) (PMEL/2038), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details