Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi A UPF0060 membrane protein ynfA (ynfA)

This Recombinant Salmonella paratyphi A UPF0060 membrane protein ynfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ynfA

UniProt

B5BK72

Expression Region

1-108

Origin

Salmonella paratyphi A (strain AKU_12601)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKTTLLFFVTALCEIIGCFLPWLWIKRGASVWWLLPAAASLALFVWLLTLHPAASGRVY AAYGGVYVCTALLWLRVVDGVRLTVYDWCGALIALCGMLIIVVGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL
BNC880342-500 1x 500 µL

CD43 (84-3C1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL
BNC040178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (B-B12), CF405S conjugate, 0.1mg/mL
BNC041052-100 1x 100 µL

CD3e (B-B12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL
BNC741429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL
BNC401081-500 1x 500 µL

CD45RO (190-2F2.5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details