Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA)

This Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ynfA

UniProt

B1LEV4

Expression Region

1-108

Origin

Escherichia coli (strain SMS-3-5 / SECEC)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALIWLRVVDGVKLSLYDWTGALIALCGMLIIVAGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Desmin Antibody
KC-18508-01 50 μL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
KC-18508-02 100 µL

Desmin Antibody

Sign In for Pricing
View Details
Desmin Antibody
KC-18508-03 1 mL

Desmin Antibody

Sign In for Pricing
View Details
TBC1D3 Human Gene Knockout Kit (CRISPR)
KN425941 1 Kit

TBC1D3 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Cytokeratin 8 (H1 + TS1), Biotin conjugate, 0.1mg/mL
BNCB0687-100 1x 100 µL

Cytokeratin 8 (H1 + TS1), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human RBMXL3 activation kit by CRISPRa
GA115354 1 Kit

Human RBMXL3 activation kit by CRISPRa

Sign In for Pricing
View Details