Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA)

This Recombinant Escherichia coli UPF0060 membrane protein ynfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein ynfA

UniProt

B1LEV4

Expression Region

1-108

Origin

Escherichia coli (strain SMS-3-5 / SECEC)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALIWLRVVDGVKLSLYDWTGALIALCGMLIIVAGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Annexin A6 Antibody
8C0126-AAT 50 µg

Annexin A6 Antibody

Sign In for Pricing
View Details
SFRS12 (SREK1) Human Gene Knockout Kit (CRISPR)
KN422671 1 Kit

SFRS12 (SREK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
IGF1R Polyclonal Antibody
E-AB-68327-01 60 µL

IGF1R Polyclonal Antibody

Sign In for Pricing
View Details
IGF1R Polyclonal Antibody
E-AB-68327-02 120 µL

IGF1R Polyclonal Antibody

Sign In for Pricing
View Details
IGF1R Polyclonal Antibody
E-AB-68327-03 200 µL

IGF1R Polyclonal Antibody

Sign In for Pricing
View Details
BAG5 (NM_001015048) Human Over-expression Lysate
LC423114 20 µg

BAG5 (NM_001015048) Human Over-expression Lysate

Sign In for Pricing
View Details