Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0060 membrane protein SAOUHSC_02615 (SAOUHSC_02615)

This Recombinant Staphylococcus aureus UPF0060 membrane protein SAOUHSC_02615 (SAOUHSC_02615) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein SAOUHSC_02615

UniProt

Q2FVS6

Expression Region

1-108

Origin

Staphylococcus aureus (strain NCTC 8325)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGAILMLYGVIATFQSFPSFGRV YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P53 (PAb122), CF568 conjugate, 0.1mg/mL
BNC680338-100 1x 100 µL

P53 (PAb122), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF555 conjugate, 0.1mg/mL
BNC550333-500 1x 500 µL

CD8 (RIV11), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL
BNC471081-500 1x 500 µL

CD45RO (190-2F2.5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details