Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Staphylococcus aureus UPF0060 membrane protein SAR2425 (SAR2425)

This Recombinant Staphylococcus aureus UPF0060 membrane protein SAR2425 (SAR2425) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein SAR2425

UniProt

Q6GE96

Expression Region

1-108

Origin

Staphylococcus aureus (strain MRSA252)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLYPIFIFILAGLCEIGGGYLIWLWLREGQSSLVGLIGGVILMLYGVIATFQSFPSFGRV YAAYGGVFIIMSLIFAMVVDKQMPDKYDVIGAIICIVGVLVMLLPSRA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)
MBS965716-01 0.02 mg (E-Coli)

Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)

Sign In for Pricing
View Details
Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)
MBS965716-02 0.1 mg (E-Coli)

Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)

Sign In for Pricing
View Details
Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)
MBS965716-03 0.02 mg (Yeast)

Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)

Sign In for Pricing
View Details
Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)
MBS965716-04 0.1 mg (Yeast)

Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)

Sign In for Pricing
View Details
Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)
MBS965716-05 0.02 mg (Baculovirus)

Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)

Sign In for Pricing
View Details
Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)
MBS965716-06 0.02 mg (Mammalian-Cell)

Recombinant Human Spermatid-specific linker histone H1-like protein (HILS1)

Sign In for Pricing
View Details