Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein YnfA (ynfA)

This Recombinant UPF0060 membrane protein YnfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein YnfA

UniProt

Q83L10

Expression Region

1-108

Origin

Shigella flexneri

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLSLYDWTGALIALCGMLIIVAGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit
CK-bio-10066-01 48 Tests

Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit

Sign In for Pricing
View Details
Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit
CK-bio-10066-02 96 Tests

Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit

Sign In for Pricing
View Details
Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit
CK-bio-10066-03 5x 96 Tests

Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit

Sign In for Pricing
View Details
Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit
CK-bio-10066-04 10x 96 Tests

Human 8-iso prostaglandin F2α,8-iso-PGF2a ELISA Kit

Sign In for Pricing
View Details
TSPYL3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
48633154 3x 1.0 µg DNA

TSPYL3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
LOC680045 Protein Vector (Rat) (pPM-C-His)
PV279069 500 ng

LOC680045 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details