Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein YnfA (ynfA)

This Recombinant UPF0060 membrane protein YnfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein YnfA

UniProt

Q8FHC6

Expression Region

1-108

Origin

Escherichia coli O6

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALIWLRVVDGVKLTLYDWTGALIALCGMLIIVAGWGRT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nalgene Cryobox 81x1.2/2ml Vials
CRY8302 4 / PCK

Nalgene Cryobox 81x1.2/2ml Vials

Sign In for Pricing
View Details
MAS1L Adenovirus (Human)
28132051 1.0 mL

MAS1L Adenovirus (Human)

Sign In for Pricing
View Details
Mouse Monoclonal MCM7 Antibody (MCM7/1469) [Dylight 594]
NBP2-59614DL594 0.1 mL

Mouse Monoclonal MCM7 Antibody (MCM7/1469) [Dylight 594]

Sign In for Pricing
View Details
A-Ethyl-3- (trifluoromethyl) benzeneacetic acid
PC111692-01 100 mg

A-Ethyl-3- (trifluoromethyl) benzeneacetic acid

Sign In for Pricing
View Details
A-Ethyl-3- (trifluoromethyl) benzeneacetic acid
PC111692-02 250 mg

A-Ethyl-3- (trifluoromethyl) benzeneacetic acid

Sign In for Pricing
View Details
A-Ethyl-3- (trifluoromethyl) benzeneacetic acid
PC111692-03 500 mg

A-Ethyl-3- (trifluoromethyl) benzeneacetic acid

Sign In for Pricing
View Details