Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein YnfA (ynfA)

This Recombinant UPF0060 membrane protein YnfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein YnfA

UniProt

Q8Z6Z2

Expression Region

1-108

Origin

Salmonella typhi

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKTTLLFFVTALCEIIGCFLPWLWIKRGASVWWLLPAAASLALFVWLLTLHPAASGRVY AAYGGVYVCTALLWLRVVDGVRLTVYDWSGALIALCGMLIIVVGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

1 inch wide x 500 inch Silver Labeling Tape
TAP1210 1 Each

1 inch wide x 500 inch Silver Labeling Tape

Sign In for Pricing
View Details
Ifna2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K3292905 3x 1.0 µg

Ifna2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor Recombinant Rabbit mAb
BS45588-01 50 µL

Angiotensin II Type 1 Receptor Recombinant Rabbit mAb

Sign In for Pricing
View Details
Angiotensin II Type 1 Receptor Recombinant Rabbit mAb
BS45588-02 100 µL

Angiotensin II Type 1 Receptor Recombinant Rabbit mAb

Sign In for Pricing
View Details
Recombinant Human G-protein coupled receptor 124 (GPR124) , partial
MBS7097546 Inquire

Recombinant Human G-protein coupled receptor 124 (GPR124) , partial

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) RECF Polyclonal Antibody
MBS7185439 Inquire

Rabbit anti-Escherichia coli (strain SMS-3-5/SECEC) RECF Polyclonal Antibody

Sign In for Pricing
View Details