Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein YnfA (ynfA)

This Recombinant UPF0060 membrane protein YnfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein YnfA

UniProt

Q8Z6Z2

Expression Region

1-108

Origin

Salmonella typhi

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKTTLLFFVTALCEIIGCFLPWLWIKRGASVWWLLPAAASLALFVWLLTLHPAASGRVY AAYGGVYVCTALLWLRVVDGVRLTVYDWSGALIALCGMLIIVVGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Normal Rat Serum
B2010928 5 mL

Normal Rat Serum

Sign In for Pricing
View Details
Mouse PDE8A siRNA
abx928102-01 15 nmol

Mouse PDE8A siRNA

Sign In for Pricing
View Details
Mouse PDE8A siRNA
abx928102-02 30 nmol

Mouse PDE8A siRNA

Sign In for Pricing
View Details
DC661
BA2791-5.1 1 mL (10 mM in DMSO)

DC661

Sign In for Pricing
View Details
6-hydroxyl kaempherol-3,6-O-diglucosyl-7-O-Glucuronic acid
TBW00803 5mg

6-hydroxyl kaempherol-3,6-O-diglucosyl-7-O-Glucuronic acid

Sign In for Pricing
View Details
PAPOLA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
35991066 1.0 µg DNA

PAPOLA Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details