Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein YnfA (ynfA)

This Recombinant UPF0060 membrane protein YnfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein YnfA

UniProt

Q8X7A6

Expression Region

1-108

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGPLIALCGMLIIVVGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eph receptor A7 (EPHA7) Rabbit Polyclonal Antibody
AP14289PU-N 400 µL

Eph receptor A7 (EPHA7) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Tbpl2 Mouse Gene Knockout Kit (CRISPR)
KN517279 1 Kit

Tbpl2 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD162 (SELPLG) Mouse Monoclonal Antibody [Clone ID: TC2]
AM12002FC-N 100 Tests

CD162 (SELPLG) Mouse Monoclonal Antibody [Clone ID: TC2]

Sign In for Pricing
View Details
PPHLN1 (NM_001143787) Human Over-expression Lysate
LY428347 100 µg

PPHLN1 (NM_001143787) Human Over-expression Lysate

Sign In for Pricing
View Details
Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI1A8]
CF805833 100 µg

Gemin 8 (GEMIN8) Mouse Monoclonal Antibody [Clone ID: OTI1A8]

Sign In for Pricing
View Details
IL 2 Human, His
OM296648-01 10 µg

IL 2 Human, His

Sign In for Pricing
View Details