Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein YnfA (ynfA)

This Recombinant UPF0060 membrane protein YnfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein YnfA

UniProt

Q8X7A6

Expression Region

1-108

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGPLIALCGMLIIVVGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

P18 INK Antibody
8C0288-AAT 50 µg

P18 INK Antibody

Sign In for Pricing
View Details
Polystyrene C4 NH₂
HB12516002.100G 100 g

Polystyrene C4 NH₂

Sign In for Pricing
View Details
Flupirtine maleate
SIH-376-50MG 50 mg

Flupirtine maleate

Sign In for Pricing
View Details
3Alpha,4Beta-Dihydroxy-5Alpha-androstan-17-one
TRC-D488270-50MG 50 mg

3Alpha,4Beta-Dihydroxy-5Alpha-androstan-17-one

Sign In for Pricing
View Details
Rgl1 Mouse Gene Knockout Kit (CRISPR)
KN514718 1 Kit

Rgl1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100B (Astrocyte and Melanoma Marker), CF488A conjugate, 0.1mg/mL
BNC881727-500 1x 500 µL

S100B (Astrocyte and Melanoma Marker), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details