Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0060 membrane protein YnfA (ynfA)

This Recombinant UPF0060 membrane protein YnfA (ynfA) spans the amino acid sequence from region 1-108.

Product Specifications

Product Name Alternative

UPF0060 membrane protein YnfA

UniProt

Q8X7A6

Expression Region

1-108

Origin

Escherichia coli O157:H7

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIKTTLLFFATALCEIIGCFLPWLWLKRNASIWLLLPAGISLALFVWLLTLHPAASGRVY AAYGGVYVCTALMWLRVVDGVKLTLYDWTGPLIALCGMLIIVVGWGRT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD71 (TFRC/1059), Biotin conjugate, 0.1mg/mL
BNCB1059-100 1x 100 µL

CD71 (TFRC/1059), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CEP57 Human Gene Knockout Kit (CRISPR)
KN401469 1 Kit

CEP57 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Haptoglobin (HP) Rabbit Polyclonal Antibody
TA377204 100 µL

Haptoglobin (HP) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Cyclin D1 (CCND1/809), CF647 conjugate, 0.1mg/mL
BNC470809-500 1x 500 µL

Cyclin D1 (CCND1/809), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Acetylated-Lysine Recombinant Rabbit multiclonal Antibody
HA723173 100 µL

Acetylated-Lysine Recombinant Rabbit multiclonal Antibody

Sign In for Pricing
View Details
HECW1 (NM_001287059) Human Tagged ORF Clone
RG240179 10 µg

HECW1 (NM_001287059) Human Tagged ORF Clone

Sign In for Pricing
View Details