Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Spermidine export protein MdtI (mdtI)

This Recombinant Enterobacter sp. Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

A4WA58

Expression Region

1-109

Origin

Enterobacter sp. (strain 638)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFEWIHAAWLAFAIVLEIIANVFLKFSDGFRRKWFGLLSIAAVLGAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNRKGWIGLVLLLAGMVMIKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Calpain small subunit 1 Monoclonal Antibody
AN301453L-01 50 µL

Recombinant Calpain small subunit 1 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Calpain small subunit 1 Monoclonal Antibody
AN301453L-02 100 µL

Recombinant Calpain small subunit 1 Monoclonal Antibody

Sign In for Pricing
View Details
TUBB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]
TA506654AM 100 µL

TUBB1 Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1B9]

Sign In for Pricing
View Details
Phospho-eIF4EBP1 (S65) Recombinant Rabbit monoclonal Antibody
HA723106 100 µL

Phospho-eIF4EBP1 (S65) Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
Alpha 2 Antiplasmin (SERPINF2) (NM_001165921) Human Recombinant Protein
TP328342 20 µg

Alpha 2 Antiplasmin (SERPINF2) (NM_001165921) Human Recombinant Protein

Sign In for Pricing
View Details
Human IL-1RA Recombinant Rabbit Monoclonal Antibody [PSH07-03] - BSA and Azide free (Capture)
HA722788 100 µL

Human IL-1RA Recombinant Rabbit Monoclonal Antibody [PSH07-03] - BSA and Azide free (Capture)

Sign In for Pricing
View Details