Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Spermidine export protein MdtI (mdtI)

This Recombinant Citrobacter koseri Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

A8AGX4

Expression Region

1-109

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQFEWVHAAWLAMAIVLEIVANVFLKFSDGFRRKFYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNNKGWVGVVLLLIGMIMIKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C13orf8 (CHAMP1) (NM_001164145) Human Over-expression Lysate
LY432044 100 µg

C13orf8 (CHAMP1) (NM_001164145) Human Over-expression Lysate

Sign In for Pricing
View Details
Fluorescent Brightener 87 (Technical Grade)
TRC-F401320-25G 25 g

Fluorescent Brightener 87 (Technical Grade)

Sign In for Pricing
View Details
MAGic Clamp™ magnetic clamp, 3000ml Erlenmeyer (max. 4)
H1000-MR-3000 1 Each

MAGic Clamp™ magnetic clamp, 3000ml Erlenmeyer (max. 4)

Sign In for Pricing
View Details
1,2-Dipalmitoyl-sn-glycerol
TRC-D486890-25MG 25 mg

1,2-Dipalmitoyl-sn-glycerol

Sign In for Pricing
View Details
Rad52 Mouse Gene Knockout Kit (CRISPR)
KN514420 1 Kit

Rad52 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
1,3-Diphenylbutane
TRC-D487300-1G 1 g

1,3-Diphenylbutane

Sign In for Pricing
View Details