Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Spermidine export protein MdtI (mdtI)

This Recombinant Citrobacter koseri Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

A8AGX4

Expression Region

1-109

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPQFEWVHAAWLAMAIVLEIVANVFLKFSDGFRRKFYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNNKGWVGVVLLLIGMIMIKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Colon
CS710008 5x 5 µm

Tissue FFPE Sections, Colon

Sign In for Pricing
View Details
TReP132 (TRERF1) Human Gene Knockout Kit (CRISPR)
KN416740 1 Kit

TReP132 (TRERF1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A11]
TA501933AM 100 µL

Glutathione S Transferase theta 2 (GSTT2) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5A11]

Sign In for Pricing
View Details
Myelin Basic Protein Recombinant Rabbit monoclonal Antibody
IRS064 100 µL

Myelin Basic Protein Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
1,2-Benzenedicarboxylic Acid Isodecyl Isononyl Ester
TRC-B565960-10MG 10 mg

1,2-Benzenedicarboxylic Acid Isodecyl Isononyl Ester

Sign In for Pricing
View Details
SLC32A1 Antibody
KC-700-01 50 μL

SLC32A1 Antibody

Sign In for Pricing
View Details