Recombinant Salmonella heidelberg Spermidine export protein MdtI (mdtI)
This Recombinant Salmonella heidelberg Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.
Product Specifications
Product Name Alternative
Spermidine export protein MdtI
UniProt
B4THR4
Expression Region
1-109
Origin
Salmonella heidelberg (strain SL476)
Field of Research
Infectious Disease & Virology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742092-100 1x 100 µL
P53 Tumor Suppressor Protein (TP53/2092R), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470800-100 1x 100 µL
Cytokeratin 19 (KRT19/800), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042905-500 1x 500 µL
CD29 (Stem Cell Marker) (12G10), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
