Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella newport Spermidine export protein MdtI (mdtI)

This Recombinant Salmonella newport Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

B4T5B9

Expression Region

1-109

Origin

Salmonella newport (strain SL254)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL
BNC680031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL
BNC681820-100 1x 100 µL

Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
BNC040266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL
BNC040630-500 1x 500 µL

Mucin 1 / EMA / Episialin / CD227 (VU-2G7), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF647 conjugate, 0.1mg/mL
BNC470333-500 1x 500 µL

CD8 (RIV11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Smooth Muscle Actin (1A4), CF647 conjugate, 0.1mg/mL
BNC470665-100 1x 100 µL

Smooth Muscle Actin (1A4), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details