Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Spermidine export protein MdtI (mdtI)

This Recombinant Salmonella paratyphi C Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

C0Q4Y4

Expression Region

1-109

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-p53 DINP1 Antibody (7A906)
TMAC-02989-01 50 μL

Anti-p53 DINP1 Antibody (7A906)

Sign In for Pricing
View Details
Anti-p53 DINP1 Antibody (7A906)
TMAC-02989-02 100 µL

Anti-p53 DINP1 Antibody (7A906)

Sign In for Pricing
View Details
SOCS5 (NM_014011) Human Tagged ORF Clone Lentiviral Particle
RC214950L2V 200 µL

SOCS5 (NM_014011) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Mouse Anti-Mouse H-2Kk-BIOT
MBS673715-01 0.5 mg

Mouse Anti-Mouse H-2Kk-BIOT

Sign In for Pricing
View Details
Mouse Anti-Mouse H-2Kk-BIOT
MBS673715-02 5x 0.5 mg

Mouse Anti-Mouse H-2Kk-BIOT

Sign In for Pricing
View Details
Mri1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)
K7413907 1.0 µg DNA

Mri1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 2)

Sign In for Pricing
View Details