Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi C Spermidine export protein MdtI (mdtI)

This Recombinant Salmonella paratyphi C Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

C0Q4Y4

Expression Region

1-109

Origin

Salmonella paratyphi C (strain RKS4594)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFEWIHGAWLGLAIMLEIAANVLLKFSDGFRRKCYGILSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWVLFGQRLNPKGWVGVILLLAGMVMIKFA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Monoclonal ICOS Antibody (AP-MAB0857) [Alexa Fluor 750]
NBP1-06686AF750 0.1 mL

Rat Monoclonal ICOS Antibody (AP-MAB0857) [Alexa Fluor 750]

Sign In for Pricing
View Details
MDL-800
565267 5.0mg

MDL-800

Sign In for Pricing
View Details
EHBP1 Antibody
orb35163-01 50 µg

EHBP1 Antibody

Sign In for Pricing
View Details
EHBP1 Antibody
orb35163-02 100 µg

EHBP1 Antibody

Sign In for Pricing
View Details
SUSD5 (NM_015551) Human Over-expression Lysate
LS026032 100 µg

SUSD5 (NM_015551) Human Over-expression Lysate

Sign In for Pricing
View Details
Cytokeratin, pan (KRT) (MaxLight 490)
MBS6204655-01 0.1 mL

Cytokeratin, pan (KRT) (MaxLight 490)

Sign In for Pricing
View Details