Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shigella flexneri serotype 5b Spermidine export protein MdtI (mdtI)

This Recombinant Shigella flexneri serotype 5b Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q0T4H8

Expression Region

1-109

Origin

Shigella flexneri serotype 5b (strain 8401)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAQFEWVHAAWLALAIVLEIVANVFLKFSDGFRRKIFGLLSLAAVLAAFSALSQAVKGID LSVAYALWGGFGIAATLAAGWILFGQRLNRKGWIGLVLLLAGMIMVKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-01 20 µg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-02 100 µg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-03 500 µg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
Recombinant Human TUBG1/TUBG protein (His tag)
PDEH101031-04 1 mg

Recombinant Human TUBG1/TUBG protein (His tag)

Sign In for Pricing
View Details
FYN Mouse Monoclonal Antibody [Clone ID: 2A10]
AM06641SU-N 100 µL

FYN Mouse Monoclonal Antibody [Clone ID: 2A10]

Sign In for Pricing
View Details
Aspoxicillin (~80%)
TRC-A788675-50MG 50 mg

Aspoxicillin (~80%)

Sign In for Pricing
View Details