Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Spermidine export protein MdtI (mdtI)

This Recombinant Sodalis glossinidius Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q2NVC1

Expression Region

1-109

Origin

Sodalis glossinidius (strain morsitans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFDLYHSGFLASAVVLEILANILLKMSDGFRKLWLGLLSLLAVLGAFSALSQAVKGID LSVAYALWGGFGIAATIAAGWIMFNQRLSSRGWAGLVLLLIGMLVIKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EGFR pThr678 Rabbit Polyclonal Antibody
AP02461PU-N 100 µL

EGFR pThr678 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
8-Chlorocarbazole-1-acetic Acid
TRC-C368360-25MG 25 mg

8-Chlorocarbazole-1-acetic Acid

Sign In for Pricing
View Details
Human ZNF22-AS1 activation kit by CRISPRa
GA116581 1 Kit

Human ZNF22-AS1 activation kit by CRISPRa

Sign In for Pricing
View Details
ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3260), 0.2mg/mL
BNUB3260-100 1x 100 µL

ICOS-L / ICOS Ligand / B7RP-1 (Immuno-Oncology Target) (ICOSL/3260), 0.2mg/mL

Sign In for Pricing
View Details
5mL MacroTubes®
C2500-AST 200 Sheets/Pack

5mL MacroTubes®

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Human IgG,  20nm
GM-07-20 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Human IgG, 20nm

Sign In for Pricing
View Details