Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Spermidine export protein MdtI (mdtI)

This Recombinant Sodalis glossinidius Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q2NVC1

Expression Region

1-109

Origin

Sodalis glossinidius (strain morsitans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFDLYHSGFLASAVVLEILANILLKMSDGFRKLWLGLLSLLAVLGAFSALSQAVKGID LSVAYALWGGFGIAATIAAGWIMFNQRLSSRGWAGLVLLLIGMLVIKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mix-n-StainTM CF®583R Antibody Labeling Kit, 1x (20-50ug) labeling
#92456 1 Kit

Mix-n-StainTM CF®583R Antibody Labeling Kit, 1x (20-50ug) labeling

Sign In for Pricing
View Details
Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 0.2mg/mL
BNUB0637-100 1x 100 µL

Renal Cell Carcinoma (Carbonic Anhydrase IX) (PN-15), 0.2mg/mL

Sign In for Pricing
View Details
CDC25B Rabbit Polyclonal Antibody
AP13957PU-N 400 µL

CDC25B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human ZNF362 activation kit by CRISPRa
GA115697 1 Kit

Human ZNF362 activation kit by CRISPRa

Sign In for Pricing
View Details
4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,11-Heptadecafluoroundecanoic Acid
TRC-H265040-250MG 250 mg

4,4,5,5,6,6,7,7,8,8,9,9,10,10,11,11,11-Heptadecafluoroundecanoic Acid

Sign In for Pricing
View Details
QuantiChrom™ DPPH Antioxidant Capacity Assay Kit
DAOC-120 120 Tests

QuantiChrom™ DPPH Antioxidant Capacity Assay Kit

Sign In for Pricing
View Details