Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sodalis glossinidius Spermidine export protein MdtI (mdtI)

This Recombinant Sodalis glossinidius Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q2NVC1

Expression Region

1-109

Origin

Sodalis glossinidius (strain morsitans)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQFDLYHSGFLASAVVLEILANILLKMSDGFRKLWLGLLSLLAVLGAFSALSQAVKGID LSVAYALWGGFGIAATIAAGWIMFNQRLSSRGWAGLVLLLIGMLVIKLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DAP Kinase 1 (DAPK1) Human Gene Knockout Kit (CRISPR)
KN415423 1 Kit

DAP Kinase 1 (DAPK1) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185L-01 50 Tests

Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185L-02 100 Tests

Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]
E-AB-F1185L-03 2x 100 Tests

Elab Fluor® 488 Anti-Mouse CD5 Antibody[53-7.3]

Sign In for Pricing
View Details
PRKRA Mouse Monoclonal Antibody [Clone ID: 1B9-1A7]
AM31083PU-N 50 µg

PRKRA Mouse Monoclonal Antibody [Clone ID: 1B9-1A7]

Sign In for Pricing
View Details
C2orf52 (NM_173513) Human Recombinant Protein
TP307309L 1 mg

C2orf52 (NM_173513) Human Recombinant Protein

Sign In for Pricing
View Details