Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q66AS8

Expression Region

1-109

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYAMWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Monoclonal CD300c Antibody (072) [Janelia Fluor 549]
NBP2-89991JF549 0.1 mL

Rabbit Monoclonal CD300c Antibody (072) [Janelia Fluor 549]

Sign In for Pricing
View Details
Lentiviral mouse Rdx shRNA (UAS) - Lentiviral mouse Rdx shRNA (UAS, iRFP) (100)
GTR15222759 1 Vial

Lentiviral mouse Rdx shRNA (UAS) - Lentiviral mouse Rdx shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
AKAP associated Sperm Protein (ROPN1L) (NM_031916) Human Over-expression Lysate
LC410431 20 µg

AKAP associated Sperm Protein (ROPN1L) (NM_031916) Human Over-expression Lysate

Sign In for Pricing
View Details
Multi-species (Mouse, Rat) CCL5 (RANTES) Recombinant Protein
RP0984M-01 5 µg

Multi-species (Mouse, Rat) CCL5 (RANTES) Recombinant Protein

Sign In for Pricing
View Details
Multi-species (Mouse, Rat) CCL5 (RANTES) Recombinant Protein
RP0984M-02 25 µg

Multi-species (Mouse, Rat) CCL5 (RANTES) Recombinant Protein

Sign In for Pricing
View Details
GPR176 Double Nickase Plasmid (m2)
sc-436288-NIC-2 20 µg

GPR176 Double Nickase Plasmid (m2)

Sign In for Pricing
View Details