Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Spermidine export protein MdtI (mdtI)

This Recombinant Spermidine export protein MdtI (mdtI) spans the amino acid sequence from region 1-109.

Product Specifications

Product Name Alternative

Spermidine export protein MdtI

UniProt

Q66AS8

Expression Region

1-109

Origin

Yersinia pseudotuberculosis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MQQLEFYPIAFLILAVMLEIVANILLKMSDGFRRKWLGILSLLSVLGAFSALAQAVKGIE LSVAYAMWGGFGIAATVAAGWILFNQRLNYKGWIGLILLLAGMVMIKLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

YIL781 hydrochloride
MBS5778832 Inquire

YIL781 hydrochloride

Sign In for Pricing
View Details
Topo IIα Lentiviral Activation Particles (h2)
sc-400869-LAC-2 200 µL

Topo IIα Lentiviral Activation Particles (h2)

Sign In for Pricing
View Details
Recombinant Human FGF21 Protein, N-His-SUMO
AP96821 50 µg

Recombinant Human FGF21 Protein, N-His-SUMO

Sign In for Pricing
View Details
Mouse Monoclonal Relaxin R1/LGR7 Antibody (933344) [mFluor Violet 500 SE]
FAB8898MFV500 0.1 mL

Mouse Monoclonal Relaxin R1/LGR7 Antibody (933344) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Tmem63a (NM_144794) Mouse Tagged ORF Clone
MG210748 10 µg

Tmem63a (NM_144794) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Collagen Type III (COL3A1, Collagen alpha-1 (III) Chain) (FITC)
125197-FITC 100 µL

Collagen Type III (COL3A1, Collagen alpha-1 (III) Chain) (FITC)

Sign In for Pricing
View Details